SFRS1 antibody (70R-4614)

Rabbit polyclonal SFRS1 antibody

Synonyms Polyclonal SFRS1 antibody, Anti-SFRS1 antibody, SFRS 1, SFRS1, SFRS-1, Splicing Factor 2 Alternate Splicing Factor antibody, SFRS 1 antibody, SFRS-1 antibody, Splicing Factor Arginine/Serine-Rich 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
Assay Information SFRS1 Blocking Peptide, catalog no. 33R-2415, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody

Images

Western Blot analysis using SFRS1 antibody (70R-4614)

SFRS1 antibody (70R-4614) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFRS1 antibody (70R-4614) | SFRS1 antibody (70R-4614) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors