SFRS12 antibody (70R-4438)

Rabbit polyclonal SFRS12 antibody raised against the N terminal of SFRS12

Synonyms Polyclonal SFRS12 antibody, Anti-SFRS12 antibody, DKFZp564B176 antibody, SRrp508 antibody, Splicing Factor Arginine/Serine-Rich 12 antibody, SFRS12, SFRS 12 antibody, SFRS-12, SFRS-12 antibody, MGC133045 antibody, SFRS 12, SRrp86 antibody
Specificity SFRS12 antibody was raised against the N terminal of SFRS12
Cross Reactivity Human
Applications WB
Immunogen SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL
Assay Information SFRS12 Blocking Peptide, catalog no. 33R-2117, is also available for use as a blocking control in assays to test for specificity of this SFRS12 antibody


Western Blot analysis using SFRS12 antibody (70R-4438)

SFRS12 antibody (70R-4438) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SFRS12 antibody (70R-4438) | SFRS12 antibody (70R-4438) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors