SFRS3 antibody (70R-4718)

Rabbit polyclonal SFRS3 antibody raised against the N terminal of SFRS3

Synonyms Polyclonal SFRS3 antibody, Anti-SFRS3 antibody, SFRS 3 antibody, SFRS3, SFRS-3 antibody, SRp20 antibody, SFRS 3, SFRS-3, Splicing Factor Arginine/Serine-Rich 3 antibody
Specificity SFRS3 antibody was raised against the N terminal of SFRS3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SFRS3 antibody was raised using the N terminal of SFRS3 corresponding to a region with amino acids SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS
Assay Information SFRS3 Blocking Peptide, catalog no. 33R-8935, is also available for use as a blocking control in assays to test for specificity of this SFRS3 antibody


Western blot analysis using SFRS3 antibody (70R-4718)

Recommended SFRS3 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS3 belongs to the splicing factor SR family. It contains 1 RRM (RNA recognition motif) domain. It may be involved in RNA processing in relation with cellular proliferation and/or maturation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SFRS3 antibody (70R-4718) | Recommended SFRS3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors