SFRS7 antibody (70R-5017)

Rabbit polyclonal SFRS7 antibody raised against the N terminal of SFRS7

Synonyms Polyclonal SFRS7 antibody, Anti-SFRS7 antibody, ZCCHC20 antibody, ZCRB2 antibody, SFRS7, RBM37 antibody, SFRS 7, SFRS-7, AAG3 antibody, SFRS-7 antibody, 9G8 antibody, SFRS 7 antibody, HSSG1 antibody, Splicing Factor Arginine/Serine-Rich 7 35Kda antibody
Specificity SFRS7 antibody was raised against the N terminal of SFRS7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SFRS7 antibody was raised using the N terminal of SFRS7 corresponding to a region with amino acids MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA
Assay Information SFRS7 Blocking Peptide, catalog no. 33R-6493, is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody

Images

Western Blot analysis using SFRS7 antibody (70R-5017)

SFRS7 antibody (70R-5017) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFRS7 antibody (70R-5017) | SFRS7 antibody (70R-5017) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors