SFRS9 antibody (70R-4884)

Rabbit polyclonal SFRS9 antibody raised against the middle region of SFRS9

Synonyms Polyclonal SFRS9 antibody, Anti-SFRS9 antibody, SFRS 9, Splicing Factor Arginine/Serine-Rich 9 antibody, SFRS-9, SRp30c antibody, SFRS9, SFRS 9 antibody, SFRS-9 antibody
Specificity SFRS9 antibody was raised against the middle region of SFRS9
Cross Reactivity Human, Mouse, Rat, C.elegans
Applications WB
Immunogen SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER
Assay Information SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Images

Western Blot analysis using SFRS9 antibody (70R-4884)

SFRS9 antibody (70R-4884) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFRS9 antibody (70R-4884) | SFRS9 antibody (70R-4884) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors