SFTPC antibody (70R-7062)

Rabbit polyclonal SFTPC antibody raised against the N terminal of SFTPC

Synonyms Polyclonal SFTPC antibody, Anti-SFTPC antibody, SFTP2 antibody, SP-C antibody, PSP-C antibody, Surfactant Pulmonary-Associated Protein C antibody, SMDP2 antibody
Specificity SFTPC antibody was raised against the N terminal of SFTPC
Cross Reactivity Human
Applications WB
Immunogen SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI
Assay Information SFTPC Blocking Peptide, catalog no. 33R-5881, is also available for use as a blocking control in assays to test for specificity of this SFTPC antibody

Images

Immunohistochemical staining using SFTPC antibody (70R-7062)

SFTPC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFTPC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SFTPC antibody (70R-7062) | SFTPC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SFTPC antibody (70R-7062) | SFTPC antibody (70R-7062) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using SFTPC antibody (70R-7062) | SFTPC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors