SFTPD antibody (70R-5911)

Rabbit polyclonal SFTPD antibody raised against the middle region of SFTPD

Synonyms Polyclonal SFTPD antibody, Anti-SFTPD antibody, SFTP4 antibody, Surfactant Pulmonary-Associated Protein D antibody, COLEC7 antibody, SP-D antibody, PSP-D antibody
Specificity SFTPD antibody was raised against the middle region of SFTPD
Cross Reactivity Human
Applications WB
Immunogen SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA
Assay Information SFTPD Blocking Peptide, catalog no. 33R-7253, is also available for use as a blocking control in assays to test for specificity of this SFTPD antibody

Images

Western Blot analysis using SFTPD antibody (70R-5911)

SFTPD antibody (70R-5911) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFTPD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFTPD antibody (70R-5911) | SFTPD antibody (70R-5911) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors