SGCE antibody (70R-6701)

Rabbit polyclonal SGCE antibody raised against the N terminal of SGCE

Synonyms Polyclonal SGCE antibody, Anti-SGCE antibody, ESG antibody, DYT11 antibody, Sarcoglycan Epsilon antibody
Specificity SGCE antibody was raised against the N terminal of SGCE
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
Assay Information SGCE Blocking Peptide, catalog no. 33R-9378, is also available for use as a blocking control in assays to test for specificity of this SGCE antibody

Images

Immunohistochemical staining using SGCE antibody (70R-6701)

pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0ug/ml using SGCE antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SGCE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SGCE antibody (70R-6701) | pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0ug/ml using SGCE antibody
  • Western blot analysis using SGCE antibody (70R-6701) | Tissue analyzed: 721_B; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using SGCE antibody (70R-6701) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using SGCE antibody (70R-6701) | Recommended SGCE Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using SGCE antibody (70R-6701) | Tissue analyzed: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors