SGK1 antibody (70R-6014)

Rabbit polyclonal SGK1 antibody raised against the N terminal of SGK1

Synonyms Polyclonal SGK1 antibody, Anti-SGK1 antibody, SGK-1, SGK 1, SGK1, SGK 1 antibody, SGK antibody, SGK-1 antibody, Serum/Glucocorticoid Regulated Kinase 1 antibody
Specificity SGK1 antibody was raised against the N terminal of SGK1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SGK1 antibody was raised using the N terminal of SGK1 corresponding to a region with amino acids ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
Assay Information SGK1 Blocking Peptide, catalog no. 33R-1406, is also available for use as a blocking control in assays to test for specificity of this SGK1 antibody

Images

Western Blot analysis using SGK1 antibody (70R-6014)

SGK1 antibody (70R-6014) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SGK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SGK1 antibody (70R-6014) | SGK1 antibody (70R-6014) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors