SGMS2 antibody (70R-6925)

Rabbit polyclonal SGMS2 antibody raised against the N terminal of SGMS2

Synonyms Polyclonal SGMS2 antibody, Anti-SGMS2 antibody, MGC26963 antibody, SGMS-2 antibody, Sphingomyelin Synthase 2 antibody, SGMS2, SMS2 antibody, SGMS 2, SGMS-2, SGMS 2 antibody
Specificity SGMS2 antibody was raised against the N terminal of SGMS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SGMS2 antibody was raised using the N terminal of SGMS2 corresponding to a region with amino acids KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY
Assay Information SGMS2 Blocking Peptide, catalog no. 33R-4377, is also available for use as a blocking control in assays to test for specificity of this SGMS2 antibody

Images

Western Blot analysis using SGMS2 antibody (70R-6925)

SGMS2 antibody (70R-6925) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SGMS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SGMS2 is a bidirectional lipid cholinephosphotransferase capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. SGMS2 directly and specifically recognises the choline head group on the substrate. SGMS2 also requires two fatty chains on the choline-P donor molecule in order to be recognised efficiently as a substrate. SGMS2 does not function strictly as a SM synthase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SGMS2 antibody (70R-6925) | SGMS2 antibody (70R-6925) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors