SGPP2 antibody (70R-1195)

Rabbit polyclonal SGPP2 antibody raised against the C terminal of SGPP2

Synonyms Polyclonal SGPP2 antibody, Anti-SGPP2 antibody, SPP2 antibody, SGPP-2, FLJ39004 antibody, Sphingosine-1-Phosphate Phosphotase 2 antibody, SGPP2, SGPP-2 antibody, SGPP 2 antibody, SGPP 2
Specificity SGPP2 antibody was raised against the C terminal of SGPP2
Cross Reactivity Human
Applications IHC, WB
Immunogen SGPP2 antibody was raised using the C terminal of SGPP2 corresponding to a region with amino acids SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL
Assay Information SGPP2 Blocking Peptide, catalog no. 33R-8562, is also available for use as a blocking control in assays to test for specificity of this SGPP2 antibody

Images

Immunohistochemical staining using SGPP2 antibody (70R-1195)

SGPP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SGPP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In vitro, SGPP2 has high phosphohydrolase activity against dihydrosphingosine-1-phosphate and sphingosine-1-phosphate (S1P).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SGPP2 antibody (70R-1195) | SGPP2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows)  in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SGPP2 antibody (70R-1195) | SGPP2 antibody (70R-1195) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $315.00
Size: 100 ug
OR
Shipping
View Our Distributors