SH3BP4 antibody (70R-3657)

Rabbit polyclonal SH3BP4 antibody raised against the N terminal of SH3BP4

Synonyms Polyclonal SH3BP4 antibody, Anti-SH3BP4 antibody, SHBP4-3 antibody, SHBP4 3 antibody, TTP antibody, Sh3-Domain Binding Protein 4 antibody, SHBP4 3, SHBP4-3, BOG25 antibody, SH3BP4
Specificity SH3BP4 antibody was raised against the N terminal of SH3BP4
Cross Reactivity Human
Applications WB
Immunogen SH3BP4 antibody was raised using the N terminal of SH3BP4 corresponding to a region with amino acids FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
Assay Information SH3BP4 Blocking Peptide, catalog no. 33R-3104, is also available for use as a blocking control in assays to test for specificity of this SH3BP4 antibody

Images

Western Blot analysis using SH3BP4 antibody (70R-3657)

SH3BP4 antibody (70R-3657) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 107 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3BP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SH3BP4 antibody (70R-3657) | SH3BP4 antibody (70R-3657) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors