SH3GL1 antibody (70R-3836)

Rabbit polyclonal SH3GL1 antibody raised against the N terminal of SH3GL1

Synonyms Polyclonal SH3GL1 antibody, Anti-SH3GL1 antibody, EEN antibody, SHGL1 3, SHGL1-3, Sh3-Domain Grb2-Like 1 antibody, CNSA1 antibody, SH3GL1, SH3P8 antibody, SHGL1-3 antibody, SHGL1 3 antibody, MGC111371 antibody, SH3D2B antibody
Specificity SH3GL1 antibody was raised against the N terminal of SH3GL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SH3GL1 antibody was raised using the N terminal of SH3GL1 corresponding to a region with amino acids LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
Assay Information SH3GL1 Blocking Peptide, catalog no. 33R-5248, is also available for use as a blocking control in assays to test for specificity of this SH3GL1 antibody


Western Blot analysis using SH3GL1 antibody (70R-3836)

SH3GL1 antibody (70R-3836) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3GL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SH3GL1 antibody (70R-3836) | SH3GL1 antibody (70R-3836) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors