SH3GL2 antibody (70R-5258)

Rabbit polyclonal SH3GL2 antibody raised against the middle region of SH3GL2

Synonyms Polyclonal SH3GL2 antibody, Anti-SH3GL2 antibody, SH3D2A antibody, EEN-B1 antibody, Sh3-Domain Grb2-Like 2 antibody, FLJ25015 antibody, SHGL2 3, SH3P4 antibody, SHGL2-3 antibody, SHGL2-3, SH3GL2, CNSA2 antibody, FLJ20276 antibody, SHGL2 3 antibody
Specificity SH3GL2 antibody was raised against the middle region of SH3GL2
Cross Reactivity Human,Mouse
Applications WB
Immunogen SH3GL2 antibody was raised using the middle region of SH3GL2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
Assay Information SH3GL2 Blocking Peptide, catalog no. 33R-7338, is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody

Images

Western Blot analysis using SH3GL2 antibody (70R-5258)

SH3GL2 antibody (70R-5258) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3GL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SH3GL2 antibody (70R-5258) | SH3GL2 antibody (70R-5258) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors