SHB antibody (70R-5762)

Rabbit polyclonal SHB antibody raised against the N terminal of SHB

Synonyms Polyclonal SHB antibody, Anti-SHB antibody, Src Homology 2 Domain Containing Adaptor Protein B antibody, bA3J10.2 antibody, RP11-3J10.8 antibody
Specificity SHB antibody was raised against the N terminal of SHB
Cross Reactivity Human,Mouse
Applications WB
Immunogen SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
Assay Information SHB Blocking Peptide, catalog no. 33R-2710, is also available for use as a blocking control in assays to test for specificity of this SHB antibody


Western Blot analysis using SHB antibody (70R-5762)

SHB antibody (70R-5762) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SHB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SHB antibody (70R-5762) | SHB antibody (70R-5762) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors