Shkbp1 Blocking Peptide (33R-10390)

A synthetic peptide for use as a blocking control in assays to test for specificity of Shkbp1 antibody, catalog no. 70R-8074

Synonyms Shkbp1 control peptide, Shkbp1 antibody Blocking Peptide, Anti-Shkbp1 Blocking Peptide, Sh3kbp1 binding protein 1 Blocking Peptide, B930062H15Rik Blocking Peptide, Sb1 Blocking Peptide, Shkbp1, Shkbp-1, Shkbp 1, Shkbp-1 Blocking Peptide, Shkbp 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAI
Molecular Weight 76 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors