SHMT2 antibody (70R-1287)

Rabbit polyclonal SHMT2 antibody

Synonyms Polyclonal SHMT2 antibody, Anti-SHMT2 antibody, SHMT antibody, GLYA antibody, Serine Hydroxymethyltransferase 2 antibody, SHMT 2, SHMT2, SHMT 2 antibody, SHMT-2, SHMT-2 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SHMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
Assay Information SHMT2 Blocking Peptide, catalog no. 33R-2550, is also available for use as a blocking control in assays to test for specificity of this SHMT2 antibody


Immunohistochemical staining using SHMT2 antibody (70R-1287)

SHMT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SHMT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHMT2 plays a role in interconversion of serine and glycine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SHMT2 antibody (70R-1287) | SHMT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SHMT2 antibody (70R-1287) | SHMT2 antibody (70R-1287) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SHMT2 antibody (70R-1287) | SHMT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors