SHPRH antibody (70R-4679)

Rabbit polyclonal SHPRH antibody raised against the N terminal of SHPRH

Synonyms Polyclonal SHPRH antibody, Anti-SHPRH antibody, FLJ27258 antibody, bA545I5.2 antibody, KIAA2023 antibody, Snf2 Histone Linker Phd Ring Helicase antibody, FLJ45012 antibody, FLJ37625 antibody, FLJ90837 antibody, MGC134886 antibody
Specificity SHPRH antibody was raised against the N terminal of SHPRH
Cross Reactivity Human
Applications WB
Immunogen SHPRH antibody was raised using the N terminal of SHPRH corresponding to a region with amino acids SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL
Assay Information SHPRH Blocking Peptide, catalog no. 33R-8531, is also available for use as a blocking control in assays to test for specificity of this SHPRH antibody

Images

Western Blot analysis using SHPRH antibody (70R-4679)

SHPRH antibody (70R-4679) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 190 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SHPRH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHPRH is a ubiquitously expressed protein that contains motifs characteristics of several DNA repair proteins, transcription factors, and helicases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SHPRH antibody (70R-4679) | SHPRH antibody (70R-4679) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors