SHROOM2 antibody (70R-5079)

Rabbit polyclonal SHROOM2 antibody raised against the middle region of SHROOM2

Synonyms Polyclonal SHROOM2 antibody, Anti-SHROOM2 antibody, APXL antibody, FLJ39277 antibody, SHROOM2, SHROOM-2 antibody, SHROOM-2, HSAPXL antibody, DKFZp781J074 antibody, SHROOM 2 antibody, Shroom Family Member 2 antibody, SHROOM 2
Specificity SHROOM2 antibody was raised against the middle region of SHROOM2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
Assay Information SHROOM2 Blocking Peptide, catalog no. 33R-1824, is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody


Western Blot analysis using SHROOM2 antibody (70R-5079)

SHROOM2 antibody (70R-5079) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 176 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SHROOM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SHROOM2 antibody (70R-5079) | SHROOM2 antibody (70R-5079) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors