SI antibody (70R-7230)

Rabbit polyclonal SI antibody

Synonyms Polyclonal SI antibody, Anti-SI antibody, MGC131622 antibody, MGC131621 antibody, Sucrase-Isomaltase antibody, Alpha Glucosidase antibody
Cross Reactivity Human
Applications WB
Immunogen SI antibody was raised using a synthetic peptide corresponding to a region with amino acids LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY
Assay Information SI Blocking Peptide, catalog no. 33R-5258, is also available for use as a blocking control in assays to test for specificity of this SI antibody

Images

Western Blot analysis using SI antibody (70R-7230)

SI antibody (70R-7230) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 209 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SI antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SI antibody (70R-7230) | SI antibody (70R-7230) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors