Sideroflexin 3 antibody (70R-6635)

Rabbit polyclonal Sideroflexin 3 antibody raised against the middle region of SFXN3

Synonyms Polyclonal Sideroflexin 3 antibody, Anti-Sideroflexin 3 antibody, Sideroflexin 3, BA108L7.2 antibody, Sideroflexin 3 antibody, Sideroflexin -3 antibody, SFX3 antibody, Sideroflexin -3, Sideroflexin 3, SFXN3 antibody
Specificity Sideroflexin 3 antibody was raised against the middle region of SFXN3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN
Assay Information Sideroflexin 3 Blocking Peptide, catalog no. 33R-9223, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 3 antibody


Western Blot analysis using Sideroflexin 3 antibody (70R-6635)

Sideroflexin 3 antibody (70R-6635) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFXN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFXN3 is a potential iron transporter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Sideroflexin 3 antibody (70R-6635) | Sideroflexin 3 antibody (70R-6635) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors