Sideroflexin 4 antibody (70R-7001)

Rabbit polyclonal Sideroflexin 4 antibody raised against the C terminal of SFXN4

Synonyms Polyclonal Sideroflexin 4 antibody, Anti-Sideroflexin 4 antibody, SFXN4 antibody, Sideroflexin -4, Sideroflexin 4, Sideroflexin 4 antibody, Sideroflexin -4 antibody, Sideroflexin 4, BCRM1 antibody
Specificity Sideroflexin 4 antibody was raised against the C terminal of SFXN4
Cross Reactivity Human
Applications WB
Immunogen Sideroflexin 4 antibody was raised using the C terminal of SFXN4 corresponding to a region with amino acids SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEETEIFYHRGV
Assay Information Sideroflexin 4 Blocking Peptide, catalog no. 33R-8343, is also available for use as a blocking control in assays to test for specificity of this Sideroflexin 4 antibody

Images

Western Blot analysis using Sideroflexin 4 antibody (70R-7001)

Sideroflexin 4 antibody (70R-7001) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFXN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Sideroflexin 4 antibody (70R-7001) | Sideroflexin 4 antibody (70R-7001) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors