SIDT2 antibody (70R-7049)

Rabbit polyclonal SIDT2 antibody raised against the N terminal of SIDT2

Synonyms Polyclonal SIDT2 antibody, Anti-SIDT2 antibody, SIDT-2, CGI-40 antibody, Sid1 Transmembrane Family Member 2 antibody, DKFZp686L17253 antibody, FLJ90656 antibody, SIDT 2, SIDT 2 antibody, SIDT2, SIDT-2 antibody
Specificity SIDT2 antibody was raised against the N terminal of SIDT2
Cross Reactivity Human
Applications WB
Immunogen SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT
Assay Information SIDT2 Blocking Peptide, catalog no. 33R-5227, is also available for use as a blocking control in assays to test for specificity of this SIDT2 antibody

Images

Western Blot analysis using SIDT2 antibody (70R-7049)

SIDT2 antibody (70R-7049) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIDT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIDT2 belongs to the SID1 family. It is a multi-pass membrane protein. The exact function of SIDT2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIDT2 antibody (70R-7049) | SIDT2 antibody (70R-7049) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors