SIGIRR antibody (70R-6630)

Rabbit polyclonal SIGIRR antibody

Synonyms Polyclonal SIGIRR antibody, Anti-SIGIRR antibody, TIR8 antibody, MGC110992 antibody, Single Immunoglobulin And Toll-Interleukin 1 Receptor antibody, Tir Domain antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
Assay Information SIGIRR Blocking Peptide, catalog no. 33R-7406, is also available for use as a blocking control in assays to test for specificity of this SIGIRR antibody

Images

Western blot analysis using SIGIRR antibody (70R-6630)

Recommended SIGIRR Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIGIRR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SIGIRR antibody (70R-6630) | Recommended SIGIRR Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using SIGIRR antibody (70R-6630) | Liver
  • Western blot analysis using SIGIRR antibody (70R-6630) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors