SIGLEC10 antibody (70R-6154)

Rabbit polyclonal SIGLEC10 antibody raised against the middle region of SIGLEC10

Synonyms Polyclonal SIGLEC10 antibody, Anti-SIGLEC10 antibody, PRO940 antibody, SIGLEC-10 antibody, SIGLEC 10 antibody, Sialic Acid Binding Ig-Like Lectin 10 antibody, SIGLEC-10 antibody, SLG2 antibody, SIGLEC10, SIGLEC-10, SIGLEC 10, MGC126774 antibody
Specificity SIGLEC10 antibody was raised against the middle region of SIGLEC10
Cross Reactivity Human
Applications WB
Immunogen SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL
Assay Information SIGLEC10 Blocking Peptide, catalog no. 33R-1714, is also available for use as a blocking control in assays to test for specificity of this SIGLEC10 antibody

Images

Western Blot analysis using SIGLEC10 antibody (70R-6154)

SIGLEC10 antibody (70R-6154) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIGLEC10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIGLEC10 antibody (70R-6154) | SIGLEC10 antibody (70R-6154) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors