SIGLEC12 antibody (70R-6148)

Rabbit polyclonal SIGLEC12 antibody raised against the N terminal of SIGLEC12

Synonyms Polyclonal SIGLEC12 antibody, Anti-SIGLEC12 antibody, SIGLECL1 antibody, SIGLEC12, SIGLEC-12 antibody, Sialic Acid Binding Ig-Like Lectin 12 antibody, SIGLEC-12, Siglec-L1 antibody, Siglec-12 antibody, S2V antibody, SIGLEC 12 antibody, SIGLEC 12, SLG antibody, Siglec-XII antibody, FLJ38600 antibody
Specificity SIGLEC12 antibody was raised against the N terminal of SIGLEC12
Cross Reactivity Human
Applications WB
Immunogen SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV
Assay Information SIGLEC12 Blocking Peptide, catalog no. 33R-2208, is also available for use as a blocking control in assays to test for specificity of this SIGLEC12 antibody

Images

Western Blot analysis using SIGLEC12 antibody (70R-6148)

SIGLEC12 antibody (70R-6148) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIGLEC12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIGLEC12 antibody (70R-6148) | SIGLEC12 antibody (70R-6148) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors