SIGLEC9 antibody (70R-6182)

Rabbit polyclonal SIGLEC9 antibody raised against the C terminal of SIGLEC9

Synonyms Polyclonal SIGLEC9 antibody, Anti-SIGLEC9 antibody, SIGLEC-9, SIGLEC-9 antibody, Sialic Acid Binding Ig-Like Lectin 9 antibody, OBBP-LIKE antibody, CDw329 antibody, SIGLEC 9 antibody, SIGLEC9, SIGLEC 9
Specificity SIGLEC9 antibody was raised against the C terminal of SIGLEC9
Cross Reactivity Human
Applications WB
Immunogen SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA
Assay Information SIGLEC9 Blocking Peptide, catalog no. 33R-7438, is also available for use as a blocking control in assays to test for specificity of this SIGLEC9 antibody

Images

Western Blot analysis using SIGLEC9 antibody (70R-6182)

SIGLEC9 antibody (70R-6182) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIGLEC9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIGLEC9 antibody (70R-6182) | SIGLEC9 antibody (70R-6182) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors