SIL1 antibody (70R-6272)

Rabbit polyclonal SIL1 antibody

Synonyms Polyclonal SIL1 antibody, Anti-SIL1 antibody, SIL-1 antibody, SIL-1, SIL1, SIL 1 antibody, SIL 1, ULG5 antibody, Sil1 Homolog Endoplasmic Reticulum Chaperone antibody, BAP antibody, MSS antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR
Assay Information SIL1 Blocking Peptide, catalog no. 33R-4531, is also available for use as a blocking control in assays to test for specificity of this SIL1 antibody

Images

Western Blot analysis using SIL1 antibody (70R-6272)

SIL1 antibody (70R-6272) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SIL1 antibody (70R-6272) | SIL1 antibody (70R-6272) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors