SKAP1 antibody (70R-5761)

Rabbit polyclonal SKAP1 antibody raised against the N terminal of SKAP1

Synonyms Polyclonal SKAP1 antibody, Anti-SKAP1 antibody, SKAP 1 antibody, SKAP-1 antibody, SKAP-1, SKAP55 antibody, SKAP1, SCAP1 antibody, SKAP 1, Src Kinase Associated Phosphoprotein 1 antibody
Specificity SKAP1 antibody was raised against the N terminal of SKAP1
Cross Reactivity Human
Applications WB
Immunogen SKAP1 antibody was raised using the N terminal of SKAP1 corresponding to a region with amino acids RDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFL
Assay Information SKAP1 Blocking Peptide, catalog no. 33R-7848, is also available for use as a blocking control in assays to test for specificity of this SKAP1 antibody

Images

Western Blot analysis using SKAP1 antibody (70R-5761)

SKAP1 antibody (70R-5761) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SKAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SKAP1 Is a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SKAP1 antibody (70R-5761) | SKAP1 antibody (70R-5761) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors