SLA/LP antibody (70R-4725)

Rabbit polyclonal SLA/LP antibody raised against the N terminal of SLA/LP

Synonyms Polyclonal SLA/LP antibody, Anti-SLA/LP antibody, Soluble Liver Antigen/Liver Pancreas Antigen antibody
Specificity SLA/LP antibody was raised against the N terminal of SLA/LP
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SLA/LP antibody was raised using the N terminal of SLA/LP corresponding to a region with amino acids MDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAG
Assay Information SLA/LP Blocking Peptide, catalog no. 33R-5871, is also available for use as a blocking control in assays to test for specificity of this SLA/LP antibody

Images

Immunohistochemical staining using SLA/LP antibody (70R-4725)

SLA/LP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLA/LP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLA/LP converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLA/LP antibody (70R-4725) | SLA/LP antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLA/LP antibody (70R-4725) | SLA/LP antibody (70R-4725) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors