SLAMF6 antibody (70R-7224)

Rabbit polyclonal SLAMF6 antibody raised against the N terminal of SLAMF6

Synonyms Polyclonal SLAMF6 antibody, Anti-SLAMF6 antibody, KALIb antibody, NTB-A antibody, MGC104953 antibody, SLAMF-6 antibody, SLAMF-6, SF2000 antibody, NTBA antibody, SLAMF 6, KALI antibody, Slam Family Member 6 antibody, SLAMF 6 antibody, Ly108 antibody, SLAMF6
Specificity SLAMF6 antibody was raised against the N terminal of SLAMF6
Cross Reactivity Human
Applications WB
Immunogen SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK
Assay Information SLAMF6 Blocking Peptide, catalog no. 33R-6685, is also available for use as a blocking control in assays to test for specificity of this SLAMF6 antibody

Images

Western Blot analysis using SLAMF6 antibody (70R-7224)

SLAMF6 antibody (70R-7224) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLAMF6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLAMF6 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLAMF6 antibody (70R-7224) | SLAMF6 antibody (70R-7224) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors