SLBP antibody (70R-4639)

Rabbit polyclonal SLBP antibody

Synonyms Polyclonal SLBP antibody, Anti-SLBP antibody, Stem-Loop antibody, HBP antibody, Histone Binding Protein antibody
Cross Reactivity Human,Dog,ZebraFish
Applications WB
Immunogen SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
Assay Information SLBP Blocking Peptide, catalog no. 33R-4084, is also available for use as a blocking control in assays to test for specificity of this SLBP antibody

Images

Western Blot analysis using SLBP antibody (70R-4639)

SLBP antibody (70R-4639) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLBP antibody (70R-4639) | SLBP antibody (70R-4639) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors