SLC10A5 antibody (70R-1767)

Rabbit polyclonal SLC10A5 antibody

Synonyms Polyclonal SLC10A5 antibody, Anti-SLC10A5 antibody, Solute Carrier Family 10 Sodium/Bile acid Cotransporter Member 5 antibody, SLCA5-10 antibody, SLC10A5, P5 antibody, Sodium/Bile Acid Cotransporter Family 5 antibody, SLCA5 10 antibody, SLCA5 10, SLCA5-10
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
Assay Information SLC10A5 Blocking Peptide, catalog no. 33R-3684, is also available for use as a blocking control in assays to test for specificity of this SLC10A5 antibody


Immunohistochemical staining using SLC10A5 antibody (70R-1767)

SLC10A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC10A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC10A5 antibody (70R-1767) | SLC10A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using SLC10A5 antibody (70R-1767) | SLC10A5 antibody (70R-1767) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors