SLC10A7 antibody (70R-6792)

Rabbit polyclonal SLC10A7 antibody

Synonyms Polyclonal SLC10A7 antibody, Anti-SLC10A7 antibody, SLCA7-10, SLCA7-10 antibody, Sodium/Bile Acid Cotransporter Family 7 antibody, Solute Carrier Family 10 Sodium/Bile acid Cotransporter Member 7 antibody, SLCA7 10 antibody, SLC10A7, C4orf13 antibody, MGC25043 antibody, SLCA7 10, DKFZp779O2438 antibody, P7 antibody, DKFZp313H0531 antibody, DKFZp566M114 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC10A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP
Assay Information SLC10A7 Blocking Peptide, catalog no. 33R-9313, is also available for use as a blocking control in assays to test for specificity of this SLC10A7 antibody

Images

Western Blot analysis using SLC10A7 antibody (70R-6792)

SLC10A7 antibody (70R-6792) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC10A7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC10A7 belongs to the sodium: bile acid symporter family. It is a multi-pass membrane protein. The function of SLC10A7 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC10A7 antibody (70R-6792) | SLC10A7 antibody (70R-6792) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors