SLC11A2 antibody (70R-6786)

Rabbit polyclonal SLC11A2 antibody raised against the N terminal Of Slc11A2

Synonyms Polyclonal SLC11A2 antibody, Anti-SLC11A2 antibody, DMT1 antibody, FLJ37416 antibody, DCT1 antibody, NRAMP2 antibody, Solute Carrier Family 11 Member 2 antibody, SLCA2-11 antibody, SLCA2 11 antibody, SLCA2 11, SLCA2-11, SLC11A2
Specificity SLC11A2 antibody was raised against the N terminal Of Slc11A2
Cross Reactivity Human
Applications WB
Immunogen SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF
Assay Information SLC11A2 Blocking Peptide, catalog no. 33R-9663, is also available for use as a blocking control in assays to test for specificity of this SLC11A2 antibody

Images

Western Blot analysis using SLC11A2 antibody (70R-6786)

SLC11A2 antibody (70R-6786) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC11A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC11A2 antibody (70R-6786) | SLC11A2 antibody (70R-6786) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors