SLC12A3 antibody (70R-6605)

Rabbit polyclonal SLC12A3 antibody

Synonyms Polyclonal SLC12A3 antibody, Anti-SLC12A3 antibody, SLCA3 12, TSC antibody, Sodium/Chloride Transporters 3 antibody, Solute Carrier Family 12 Sodium/Potassium/Chloride Transporters Member 3 antibody, SLC12A3, SLCA3-12, NCCT antibody, SLCA3 12 antibody, SLCA3-12 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC12A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC
Assay Information SLC12A3 Blocking Peptide, catalog no. 33R-1342, is also available for use as a blocking control in assays to test for specificity of this SLC12A3 antibody

Images

Western Blot analysis using SLC12A3 antibody (70R-6605)

SLC12A3 antibody (70R-6605) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 114 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC12A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC12A3 antibody (70R-6605) | SLC12A3 antibody (70R-6605) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors