SLC12A4 antibody (70R-5705)

Rabbit polyclonal SLC12A4 antibody

Synonyms Polyclonal SLC12A4 antibody, Anti-SLC12A4 antibody, Potassium/Chloride Transporters 4 antibody, Solute Carrier Family 12 Sodium/Potassium/Chloride Transporters Transporters Member 4 antibody, KCC1 antibody, SLCA4 12, SLCA4 12 antibody, SLCA4-12, SLC12A4, SLCA4-12 antibody, FLJ40489 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC12A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL
Assay Information SLC12A4 Blocking Peptide, catalog no. 33R-6285, is also available for use as a blocking control in assays to test for specificity of this SLC12A4 antibody


Western Blot analysis using SLC12A4 antibody (70R-5705)

SLC12A4 antibody (70R-5705) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 121 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC12A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. SLC12A4 may contribute to cell volume homeostasis in single cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC12A4 antibody (70R-5705) | SLC12A4 antibody (70R-5705) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors