SLC13A2 antibody (70R-7364)

Rabbit polyclonal SLC13A2 antibody

Synonyms Polyclonal SLC13A2 antibody, Anti-SLC13A2 antibody, SLCA2-13, SLC13A2, Sodium-Dependent Dicarboxylate Transporter 2 antibody, SLCA2-13 antibody, Solute Carrier Family 13 Sodium-dependent Dicarboxylate Transporter Member 2 antibody, NaDC-1 antibody, SLCA2 13 antibody, NADC1 antibody, SLCA2 13
Cross Reactivity Human
Applications WB
Immunogen SLC13A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD
Assay Information SLC13A2 Blocking Peptide, catalog no. 33R-7231, is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody

Images

Western Blot analysis using SLC13A2 antibody (70R-7364)

SLC13A2 antibody (70R-7364) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC13A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC13A2 antibody (70R-7364) | SLC13A2 antibody (70R-7364) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors