SLC14A1 antibody (70R-7059)

Rabbit polyclonal SLC14A1 antibody raised against the C terminal of SLC14A1

Synonyms Polyclonal SLC14A1 antibody, Anti-SLC14A1 antibody, HsT1341 antibody, FLJ41687 antibody, SLCA1 14, UTE antibody, UT1 antibody, RACH1 antibody, UT-B1 antibody, SLC14A1, SLCA1-14, Solute Carrier Family 14 Urea Transporter Member 1 antibody, JK antibody, Urea Transporter 1 antibody, HUT11 antibody, SLCA1-14 antibody, SLCA1 14 antibody, FLJ33745 antibody
Specificity SLC14A1 antibody was raised against the C terminal of SLC14A1
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
Assay Information SLC14A1 Blocking Peptide, catalog no. 33R-5455, is also available for use as a blocking control in assays to test for specificity of this SLC14A1 antibody

Images

Immunohistochemical staining using SLC14A1 antibody (70R-7059)

SLC14A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC14A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC14A1 antibody (70R-7059) | SLC14A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SLC14A1 antibody (70R-7059) | SLC14A1 antibody (70R-7059) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SLC14A1 antibody (70R-7059) | SLC14A1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors