SLC15A2 antibody (70R-6535)

Rabbit polyclonal SLC15A2 antibody

Synonyms Polyclonal SLC15A2 antibody, Anti-SLC15A2 antibody, SLCA2-15, PEPT2 antibody, SLCA2 15 antibody, Solute Carrier Family 15 H+/peptide Transporter Member 2 antibody, SLCA2-15 antibody, H+/Peptide Transporter 2 antibody, SLC15A2, SLCA2 15
Cross Reactivity Human
Applications WB
Immunogen SLC15A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
Assay Information SLC15A2 Blocking Peptide, catalog no. 33R-3445, is also available for use as a blocking control in assays to test for specificity of this SLC15A2 antibody

Images

Western Blot analysis using SLC15A2 antibody (70R-6535)

SLC15A2 antibody (70R-6535) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC15A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC15A2 belongs to the PTR2/POT transporter family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC15A2 antibody (70R-6535) | SLC15A2 antibody (70R-6535) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors