SLC15A4 antibody (70R-6547)

Rabbit polyclonal SLC15A4 antibody raised against the middle region of SLC15A4

Synonyms Polyclonal SLC15A4 antibody, Anti-SLC15A4 antibody, PHT1 antibody, SLCA4-15 antibody, Solute Carrier Family 15 Member 4 antibody, PTR4 antibody, FP12591 antibody, SLCA4 15, SLC15A4, SLCA4 15 antibody, SLCA4-15
Specificity SLC15A4 antibody was raised against the middle region of SLC15A4
Cross Reactivity Human
Applications WB
Immunogen SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
Assay Information SLC15A4 Blocking Peptide, catalog no. 33R-3409, is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody

Images

Western Blot analysis using SLC15A4 antibody (70R-6547)

SLC15A4 antibody (70R-6547) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC15A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC15A4 antibody (70R-6547) | SLC15A4 antibody (70R-6547) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors