SLC16A1 antibody (70R-6795)

Rabbit polyclonal SLC16A1 antibody

Synonyms Polyclonal SLC16A1 antibody, Anti-SLC16A1 antibody, FLJ36745 antibody, SLCA1 16 antibody, MCT antibody, MCT1 antibody, Solute Carrier Family 16 Member 1 antibody, SLCA1-16, SLCA1-16 antibody, SLC16A1, Monocarboxylic Acid Transporter 1 antibody, SLCA1 16, MGC44475 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC16A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
Assay Information SLC16A1 Blocking Peptide, catalog no. 33R-2496, is also available for use as a blocking control in assays to test for specificity of this SLC16A1 antibody


Western Blot analysis using SLC16A1 antibody (70R-6795)

SLC16A1 antibody (70R-6795) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC16A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC16A1 antibody (70R-6795) | SLC16A1 antibody (70R-6795) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors