SLC16A12 antibody (70R-6440)

Rabbit polyclonal SLC16A12 antibody

Synonyms Polyclonal SLC16A12 antibody, Anti-SLC16A12 antibody, DKFZp686E188 antibody, SLC16A12, SLCA12-16 antibody, Monocarboxylic Acid Transporter 12 antibody, Solute Carrier Family 16 Member 12 antibody, SLCA12 16, SLCA12-16, SLCA12 16 antibody, MCT12 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC16A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT
Assay Information SLC16A12 Blocking Peptide, catalog no. 33R-9979, is also available for use as a blocking control in assays to test for specificity of this SLC16A12 antibody

Images

Western Blot analysis using SLC16A12 antibody (70R-6440)

SLC16A12 antibody (70R-6440) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC16A12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a proton-linked monocarboxylate transporter, SLC16A12 catalyzes the rapid transport across the plasma membrane of many monocarboxylates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC16A12 antibody (70R-6440) | SLC16A12 antibody (70R-6440) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors