SLC17A2 antibody (70R-7000)

Rabbit polyclonal SLC17A2 antibody

Synonyms Polyclonal SLC17A2 antibody, Anti-SLC17A2 antibody, Sodium Phosphate 2 antibody, SLCA2 17, SLCA2-17 antibody, SLCA2 17 antibody, Solute Carrier Family 17 Member 2 antibody, SLC17A2, SLCA2-17
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC17A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF
Assay Information SLC17A2 Blocking Peptide, catalog no. 33R-9612, is also available for use as a blocking control in assays to test for specificity of this SLC17A2 antibody


Immunohistochemical staining using SLC17A2 antibody (70R-7000)

SLC17A2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubules (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC17A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC17A2 is a member of the solute carrier family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC17A2 antibody (70R-7000) | SLC17A2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubules (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC17A2 antibody (70R-7000) | SLC17A2 antibody (70R-7000) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors