SLC17A3 antibody (70R-6935)

Rabbit polyclonal SLC17A3 antibody

Synonyms Polyclonal SLC17A3 antibody, Anti-SLC17A3 antibody, NPT4 antibody, SLC17A3, Solute Carrier Family 17 Member 3 antibody, SLCA3 17, SLCA3 17 antibody, SLCA3-17, Sodium Phosphate 3 antibody, SLCA3-17 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC17A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS
Assay Information SLC17A3 Blocking Peptide, catalog no. 33R-3125, is also available for use as a blocking control in assays to test for specificity of this SLC17A3 antibody

Images

Western Blot analysis using SLC17A3 antibody (70R-6935)

SLC17A3 antibody (70R-6935) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC17A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC17A3 antibody (70R-6935) | SLC17A3 antibody (70R-6935) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors