SLC17A4 antibody (70R-6799)

Rabbit polyclonal SLC17A4 antibody

Synonyms Polyclonal SLC17A4 antibody, Anti-SLC17A4 antibody, SLCA4 17, KAIA2138 antibody, SLCA4 17 antibody, SLCA4-17 antibody, SLCA4-17, Solute Carrier Family 17 Member 4 antibody, KIAA2138 antibody, Sodium Phosphate 4 antibody, SLC17A4, MGC129623 antibody
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen SLC17A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL
Assay Information SLC17A4 Blocking Peptide, catalog no. 33R-10092, is also available for use as a blocking control in assays to test for specificity of this SLC17A4 antibody

Images

Immunohistochemical staining using SLC17A4 antibody (70R-6799)

SLC17A4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC17A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC17A4 antibody (70R-6799) | SLC17A4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using SLC17A4 antibody (70R-6799) | SLC17A4 antibody (70R-6799) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors