SLC17A5 antibody (70R-6694)

Rabbit polyclonal SLC17A5 antibody

Synonyms Polyclonal SLC17A5 antibody, Anti-SLC17A5 antibody, SLD antibody, Anion/Sugar Transporter 5 antibody, SLCA5 17, SLCA5-17, ISSD antibody, FLJ23268 antibody, SLCA5-17 antibody, SD antibody, SIASD antibody, Solute Carrier Family 17 Member 5 antibody, AST antibody, SLCA5 17 antibody, FLJ22227 antibody, NSD antibody, SIALIN antibody, SLC17A5
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen SLC17A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
Assay Information SLC17A5 Blocking Peptide, catalog no. 33R-4951, is also available for use as a blocking control in assays to test for specificity of this SLC17A5 antibody

Images

Immunohistochemical staining using SLC17A5 antibody (70R-6694)

SLC17A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC17A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage diseases, including infantile sialic acid storage disorder and and Salla disease, an adult form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC17A5 antibody (70R-6694) | SLC17A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SLC17A5 antibody (70R-6694) | SLC17A5 antibody (70R-6694) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using SLC17A5 antibody (70R-6694) | SLC17A5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors