SLC18A2 antibody (70R-6534)

Rabbit polyclonal SLC18A2 antibody

Synonyms Polyclonal SLC18A2 antibody, Anti-SLC18A2 antibody, MGC120478 antibody, Vesicular Monoamine 2 antibody, MGC26538 antibody, SLCA2-18 antibody, SLCA2 18 antibody, SLCA2 18, SLC18A2, SLCA2-18, Solute Carrier Family 18 Member 2 antibody, VMAT2 antibody, SVMT antibody, SVAT antibody, MGC120477 antibody, VAT2 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC18A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Assay Information SLC18A2 Blocking Peptide, catalog no. 33R-6646, is also available for use as a blocking control in assays to test for specificity of this SLC18A2 antibody

Images

Immunohistochemical staining using SLC18A2 antibody (70R-6534)

SLC18A2 (VMAT2) in the cortex of human brain was detected using SLC18A2 antibody at a dilution of 5-10 ug/ml and stained with HRP/DAB brown color stain.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC18A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SLC18A2 antibody (70R-6534) | SLC18A2 (VMAT2) in the cortex of human brain was detected using SLC18A2 antibody at a dilution of 5-10 ug/ml and stained with HRP/DAB brown color stain.
  • Western Blot analysis using SLC18A2 antibody (70R-6534) | SLC18A2 antibody (70R-6534) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors