SLC19A1 antibody (70R-1803)

Rabbit polyclonal SLC19A1 antibody

Synonyms Polyclonal SLC19A1 antibody, Anti-SLC19A1 antibody, SLCA1-19, RFC1 antibody, SLCA1-19 antibody, Solute Carrier Family 19 Member 1 antibody, SLC19A1, FOLT antibody, SLCA1 19, Folate Transporter 1 antibody, SLCA1 19 antibody, IFC1 antibody, CHMD antibody, REFC antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC19A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Assay Information SLC19A1 Blocking Peptide, catalog no. 33R-6599, is also available for use as a blocking control in assays to test for specificity of this SLC19A1 antibody


Western Blot analysis using SLC19A1 antibody (70R-1803)

SLC19A1 antibody (70R-1803) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC19A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC19A1 antibody (70R-1803) | SLC19A1 antibody (70R-1803) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors