SLC19A3 antibody (70R-7535)

Rabbit polyclonal SLC19A3 antibody raised against the middle region of SLC19A3

Synonyms Polyclonal SLC19A3 antibody, Anti-SLC19A3 antibody, SLCA3-19, SLC19A3, Solute Carrier Family 19 Member 3 antibody, SLCA3 19 antibody, SLCA3-19 antibody, SLCA3 19
Specificity SLC19A3 antibody was raised against the middle region of SLC19A3
Cross Reactivity Human,Mouse
Applications WB
Immunogen SLC19A3 antibody was raised using the middle region of SLC19A3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY
Assay Information SLC19A3 Blocking Peptide, catalog no. 33R-2848, is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody

Images

Western Blot analysis using SLC19A3 antibody (70R-7535)

SLC19A3 antibody (70R-7535) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC19A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC19A3 antibody (70R-7535) | SLC19A3 antibody (70R-7535) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors